actividadesdeinfantilyprimaria.com 69 C
🛡️ SEO 65 🤖 GEO 73 ⚡ Perf 74 🏗️ Arch 61

actividadesdeinfantilyprimaria.com — Global SEODiff Score 69/100

actividadesdeinfantilyprimaria.com
📊

At 78/100, the ACRI for actividadesdeinfantilyprimaria.com indicates strong fundamentals in AI extractability, surpassing the majority of indexed sites. Compared to other infrastructure sites (avg score: 57), actividadesdeinfantilyprimaria.com performs above the benchmark, suggesting strong competitive positioning in AI search. Content is delivered server-side, meaning bots and AI agents can parse the full page without executing JavaScript. The 11.7× token bloat ratio falls within the normal range, though there is room to trim navigation, footer, and script overhead. Minimal structured data (1 block) limits the site's ability to communicate entity relationships to AI systems. All major AI bot user-agents (GPTBot, ClaudeBot, CCBot, Google-Extended) are permitted by robots.txt, ensuring broad AI crawler access.

69
C — Global SEODiff Score
Comprehensive search visibility assessment
Strong foundations, but Architecture (61) is your bottleneck.
🎯 Top Fix: Fix title tag length → +3 pts
🔬 Automated SEODiff Assessment · Snapshot: Mar 21, 2026 · 📋 API
📈 ACRI Trend 23 snapshots
Feb 22 Mar 21
🔔 Recent AI Indexing Activity
🔄 Mar 21 Content change detected
📈 Mar 20 ACRI +1 (59→60)
🔄 Mar 20 Content change detected
📉 Mar 18 ACRI -1 (60→59)
🔄 Mar 16 Content change detected
Does your site score higher than actividadesdeinfantilyprimaria.com?
Run the same 40-signal audit on your own domain — free, instant results.
Scan Your Site Free →
🧮 Score Transparency — How is this calculated?
🛡️ Traditional SEO (25% weight)65 × 0.25 = 16.2
🤖 AI Readiness / GEO (40% weight)73 × 0.40 = 29.2
⚡ Performance (20% weight)74 × 0.20 = 14.8
🏗️ Architecture & Trust (15% weight)61 × 0.15 = 9.2
Weighted sum = 16.2 + 29.2 + 14.8 + 9.2
Global SEODiff Score = 69 (C)
📊 ACRI Sub-Scores (AI Readiness Detail)
100
Bot Access
avg 92
100
Rendering
avg 93
40
Structure
avg 35
42
Schema
avg 9
85
Tech Stack
avg 63
🔀
Visibility Delta: Google vs AI
Google (Tranco)
Top 10%
Rank #98226
Aligned
Gap
AI (ACRI)
Top 12%
Score 78/100

actividadesdeinfantilyprimaria.com has balanced Google and AI visibility — both rank roughly in the same tier. ACRI measures technical crawler readiness. Read the methodology →

Why actividadesdeinfantilyprimaria.com ranks here

Tech stackWordPress
RenderingSSR
Schema coverage1 blocks
Token bloat11.7×

Fastest improvements

  • Reduce token bloat (navigation/footer/code) so agents reach your main content faster (see Token Bloat).
  • Create an llms.txt file so AI crawlers can discover your content structure without heavy crawling. Generate llms.txt →
  • Run a full entropy audit to find which DOM regions waste the most tokens. Run Entropy Audit →
🧪

JavaScript Rendering Check

We check what AI crawlers miss when they skip JavaScript execution.

Running headless browser to simulate AI extraction…
🛡️

Traditional SEO

65/100 25 % of Global Score 🟢 High Confidence

📝 Title Tag

82 chars
Too long

Optimal range: 30–60 characters for SERP display.

📋 Meta Description

45 chars
Too short

Optimal range: 120–160 characters for snippet control.

🔤 Heading Hierarchy

  • ✓ Exactly 1 <h1> tag — found 1
  • ✓ Has <h2> headings — found 8
  • ✓ <h2> not before <h1>

🔍 Indexability

  • ✓ Canonical tag present → https://www.actividadesdeinfantilyprimaria.com/
  • ✓ No noindex directive
  • ✓ Meta viewport set
  • ✓ HTML lang attribute → es
  • ➖ Hreflang tags — N/A (single language site)
  • ✓ Googlebot allowed by robots.txt

🌐 Social / OpenGraph

  • ✓ og:title — Actividades de infantil y primaria
  • ✓ og:description — Recursos para trabajar en infantil y primaria
  • ✗ og:image
  • ✓ twitter:card — summary
📐 How the SEO Pillar score is calculated

SEO Pillar = Title (20 pts) + Meta Desc (20 pts) + Heading Hierarchy (20 pts) + Indexability (20 pts) + Social/OG (20 pts)

Each sub-score is derived from the checks above. Canonical tag, lang attribute, og:image, and a single H1 are the highest-impact items.

🤖

AI Readiness / GEO

73/100 40 % of Global Score 🟢 High Confidence

This pillar aggregates citation share, hallucination risk, bot access, schema health, and content extractability. The individual diagnostic sections below contribute to this score.

🔗

Citation Alternatives

Research
💡
Insight: In the infrastructure sector, safely.co.jp (ACRI: 90) currently has stronger AI extractability. AI models tend to prefer sources with higher semantic structure and schema coverage. Domains with ACRI < 40 see 3.5× more hallucinations. Read the research →
actividadesdeinfantilyprimaria.com
60
Your ACRI Score
90
Industry Peer ACRI
AI models prioritize pages with strong semantic structure and schema coverage. safely.co.jp has schema coverage of 3 blocks and uses WordPress. Improve your score by implementing the remediation patches below.
📊 Side-by-Side Comparison →
🚨

Hallucination Risk

Research

Is AI lying about your brand? This panel measures how likely LLMs are to hallucinate facts when extracting information from your page.

Analyzing hallucination risk…

🤖 Bot Access Matrix

GPTBot (OpenAI)
Allowed
ClaudeBot (Anthropic)
Allowed
CCBot (Common Crawl)
Allowed
Google-Extended
Allowed
Googlebot
Allowed

👻 Rendering (Ghost Ratio) Docs

Ghost Ratio 0%
0% — Safe 50% 100% — Risk
Status Server-Side Rendered (Safe)
Rendering Type SSR

📊 Structure & Information Density Docs

Structure Grade 40/100 — Fair
Structured Elements 54 elements (54 lists, 0 rows, 0 headers)
Total Words1115
Raw Density4.8%

🏷️ Schema Health Docs

Organization Schema ✅ Present
Product / Service Schema ⚠️ Not Found
Total Schema Blocks1 block(s) — Basic (low value for AI)

Schema Coverage Map

3/7 schema types detected
✅ Organization
❌ Product/Service
✅ Breadcrumb
❌ FAQ
❌ Article
✅ WebSite
💡Product / Service schema missing. AI models don't know this is a SaaS product. Add Product or SoftwareApplication schema so AI understands what you offer and can surface pricing/features.
💡FAQ schema missing. Adding FAQPage schema lets AI models directly extract Q&A pairs for Featured Snippets and chatbot answers.

📐 AI Efficiency Metrics Docs

56
AI Extractability
Low
Crawl Cost
None
Blocklist Risk
Extractability56/100 — AI models can partially extract answers from this page
Crawl CostLow (30/100) — efficient for AI crawlers to process
Blocklist RiskNone — 0 of 5 AI crawlers blocked

Token Bloat Research

8%
🗑️ 92%
Useful Content (8.3 KB)Bloat (89.4 KB)
Token Bloat Ratio11.7× — Normal

Multimodal Readiness

Visual Context50% Optimized for Vision
Image Alt Coverage8 / 16 images have alt text

TDM Rights

TDM-Reservation HeaderNot set
X-Robots-Tag: noaiNot set

🔥 Structural Entropy Check Research

0 Entropy
Poor Token Bloat: High
Noise Ratio: 91.5% · SNR: 0.09 · Signal: 2132 / Noise: 22898 tokens

🔬 AI-Crawler Simulation

See your website the way AI crawlers do. CSS stripped, structure labeled, content chunked.

🌐
This is what humans see — styled, branded, visual.
Toggle to "AI Agent View" to see what GPTBot, ClaudeBot, and other AI crawlers actually extract from this page.
🤖

AI Answer Preview

NEW

See how AI models summarize your site. Left: your actual content. Right: what the LLM extracts and says about you.

Simulating AI extraction…
🧠

The LLM Interpretation

AI-VERIFIED

SEODiff AI analyzed the extracted content of actividadesdeinfantilyprimaria.com and produced this structured business intelligence. Fields marked SEMANTIC VOID indicate information the AI could not find — a critical gap in your site’s machine-readability.

Core Offering
This website provides educational resources and activities for primary school students, including coloring pages, dynamic exercises, and interactive tools to support literacy and numeracy skills.
Target Audience
Primary school teachers, educators, and parents of children in early primary grades.
Pricing Model
⚠ SEMANTIC VOID
🏆 Competitive Moat
Unique collection of visually engaging educational resources and activities.
📊 Content Depth
6/10
⚡ Key Pain Points
• Lack of visually engaging learning materials
• Limited resources for teaching literacy and numeracy skills in a fun and interactive way
Analyzed by SEODiff AI · 2026-03-05

🔧 Tech Stack

FrameworkWordPress
AI-Readiness Score85/100
Servernginx/1.18.0 (Ubuntu)
CDN
HTTP Status200
Load Time669 ms
Raw HTML Size97.8 KB
Visible Text Size8.3 KB

Performance & Speed

74/100 20 % of Global Score 🟢 High Confidence

⏱️ Time to First Byte

669 ms
Slow — bots may time out or deprioritise

Google considers <200 ms "good". AI crawlers may have even shorter timeouts.

📦 Page Weight

613
DOM nodes
98 KB
HTML payload
Lean page — fast for bots and users

🗄️ Cache & CDN

  • ✓ Cache-Control header → max-age=3, must-revalidate
  • ✗ CDN cache status
  • ✗ CDN detected

🔬 Tracker Tax

3
tracker scripts
2
third-party domains
0.0%
token overhead
Minimal tracker load — clean signal for bots
googletagmanager.comgooglesyndication.com
📐 How the Performance Pillar score is calculated

Perf Pillar = TTFB (35 pts) + Page Weight (25 pts) + Cache/CDN (20 pts) + Tracker Tax (20 pts)

TTFB <200 ms = full marks. DOM >3000 or payload >300 KB incurs heavy penalties. Tracker scripts beyond 5 reduce score.

🏗️

Architecture & Trust

61/100 15 % of Global Score 🟡 Medium Confidence

🗺️ Sitemap & Robots

  • ✗ Sitemap declared in robots.txt
  • ✓ Googlebot allowed
  • ✓ GPTBot allowed
  • ✓ ClaudeBot allowed

🔗 Linking

207
internal links
5
external links
Good internal linking — helps crawlers discover content

🔒 Security & Trust

  • ✗ HSTS header (Strict-Transport-Security)
  • ✗ Content-Security-Policy header
  • ✓ HTTP status 200 OK (got 200)

♿ Accessibility Signals

  • ✓ HTML lang attribute → es
  • ✓ Meta viewport for mobile
  • ✓ Single H1 for screen readers
📐 How the Architecture Pillar score is calculated

Arch Pillar = Sitemap & Robots (30 pts) + Linking (25 pts) + Security (25 pts) + Accessibility (20 pts)

Having a valid sitemap, allowing AI bots, HSTS, and a good internal link count are the highest-impact items.

🏅 AI-Verified Trust Badge

Your site scores 60/100. Reach 80+ to unlock the green "AI-Verified" badge. Fix the issues below to improve your score.

AI-Verified badge for actividadesdeinfantilyprimaria.com
Pending Audit — score below 80 threshold
<a href="https://seodiff.io/radar/domains/actividadesdeinfantilyprimaria.com" rel="noopener"><img src="https://seodiff.io/api/v1/badge?domain=actividadesdeinfantilyprimaria.com" alt="AI-Verified by SEODiff" width="280" height="52"></a>

💡 Paste in your site footer, GitHub README, or email signature. Badge updates automatically as your score changes.

� Deep Crawl Analysis 21 pages · Deep-10

Homepage ACRI
60
Single-page score
+7
Consistent readability
Δ delta
Site-Wide ACRI
67
Avg across 21 pages · Range 67–67
Topical Cohesion
9%
Topical Drift
TF-IDF cosine similarity
Total Words
11414
Avg Bloat
35.7×
Page Type ACRI Token Bloat Words Status
https://actividadesdeinfantilyprimaria.com/api
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
docs 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/pricing
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/guides
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
blog 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/help
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
support 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/about
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/resources
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
blog 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/solutions
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
product 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/products
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/features
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/docs
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/blog
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/case-studies
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/get-started
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
conversion 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/demo
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
conversion 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/integrations
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/support
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
support 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/faq
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/contact
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
pricing 67 36.4× 543 💰 Pricing
https://actividadesdeinfantilyprimaria.com/trust
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
trust 67 35.1× 544
https://actividadesdeinfantilyprimaria.com/security
Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
trust 67 35.1× 544
Showing 20 of 21 pages. Unlock full subpage table →
📂
Health by Sub-Directory
Average ACRI and top issues aggregated by URL path prefix
Path Pages Avg ACRI Ghost % Bloat Top Issue
/contact/ 1 67 0% 36.4× High JS Bloat
/careers/ 1 67 0% 35.1× High JS Bloat
/solutions/ 1 67 0% 35.1× High JS Bloat
/about/ 1 67 0% 36.4× High JS Bloat
/faq/ 1 67 0% 36.4× High JS Bloat
/trust/ 1 67 0% 35.1× High JS Bloat
/guides/ 1 67 0% 35.1× High JS Bloat
/security/ 1 67 0% 35.1× High JS Bloat
/pricing/ 1 67 0% 36.4× High JS Bloat
/blog/ 1 67 0% 36.4× High JS Bloat
/docs/ 1 67 0% 36.4× High JS Bloat
/case-studies/ 1 67 0% 36.4× High JS Bloat
/integrations/ 1 67 0% 36.4× High JS Bloat
/demo/ 1 67 0% 35.1× High JS Bloat
/get-started/ 1 67 0% 35.1× High JS Bloat
🔗
Outbound External Citations
0 unique external domains cited across 21 pages
es.pinterest.com ×21
grupocafe.es ×21
creativecommons.org ×21
verificada.com ×21
facebook.com ×21
🔄 Re-Crawl & Update 📡 Track this Domain

Scores update automatically each month. Create a free account for on-demand re-crawls (3/month free).

🔌 API Access

Pull this data programmatically. All sub-page metrics are available via our public API.

curl https://seodiff.io/api/v1/deep10/domain/actividadesdeinfantilyprimaria.com

Get your free API key — 100 requests/month included.

🔗 Similar infrastructure Sites

Domains with a similar tech stack, industry, and AI readiness profile to actividadesdeinfantilyprimaria.com. Compare side-by-side.

Domain ACRI AI Score Tech Stack Token Bloat Schema
actividadesdeinfantilyprimaria.com (this site) 60 78 WordPress 11.7× 1
tokk-kansai.jp 85 90 WordPress 2.5× 1 Compare →
sbba.or.jp 85 90 WordPress 2.1× 1 Compare →
derolfgroep.nl 85 89 WordPress 1.8× 2 Compare →
ilfriuli.it 85 90 WordPress 3.4× 3 Compare →
michelangelospizza-northport.com 85 95 Cloudflare Pages 9.1× 5 Compare →
Compare All 5 Similar Sites →

📊 Semantic Share of Voice

How often would an AI cite actividadesdeinfantilyprimaria.com when users ask about topics in this domain's niche? We run entity queries through our 188k-page search index and measure citation probability.

Analyzing citation landscape…

🩹

Remediation Patches

COPY-PASTE

Auto-generated code fixes tailored to actividadesdeinfantilyprimaria.com. Copy and paste these into your codebase to improve AI visibility. These patches are mathematically proven to increase extraction accuracy →

Reduce Token Bloat
Medium Impact ⏱ 1–2 hrs
Only 8% of your HTML is useful content. AI crawlers waste context window tokens on bloat.
html
<!-- Move inline CSS to external stylesheets -->
<link rel="stylesheet" href="/css/main.css">

<!-- Move inline scripts to external files with defer -->
<script src="/js/app.js" defer></script>

<!-- Remove duplicate navigation blocks -->
<!-- Keep only ONE <nav> in the <header> -->

<!-- Ensure <main> wraps your primary content -->
<main>
  <!-- Your content here — this is what AI sees first -->
</main>
Add FAQ Schema
Medium Impact ⏱ 10 min
FAQ schema lets AI models directly extract Q&A pairs. This is the easiest way to get featured in AI responses.
html
<script type="application/ld+json">
{
  "@context": "https://schema.org",
  "@type": "FAQPage",
  "mainEntity": [
    {
      "@type": "Question",
      "name": "What is Actividadesdeinfantilyprimaria?",
      "acceptedAnswer": {
        "@type": "Answer",
        "text": "Add your answer here — describe what Actividadesdeinfantilyprimaria does in 1-2 sentences."
      }
    },
    {
      "@type": "Question",
      "name": "How does Actividadesdeinfantilyprimaria work?",
      "acceptedAnswer": {
        "@type": "Answer",
        "text": "Explain the key features and how users interact with Actividadesdeinfantilyprimaria."
      }
    }
  ]
}
</script>
📈

Projected Impact

ROI EST.

If you apply the patches above, here's the estimated improvement for actividadesdeinfantilyprimaria.com:

Current Score
78
Projected Score
86
Improvement
+8 pts
Reduce token bloat +5 pts
Add FAQ schema +3 pts

*Estimates based on SEODiff's scoring model. Actual results depend on implementation quality.

📋 Data Export

Download scores and metadata for audits, client reports, or CI/CD pipelines. Exports contain computed metrics only (no copyrighted content).

All data is generated automatically and updated with each crawl. JSON exports contain scores and metadata only (no copyrighted content).

Is this your company?

Monitor your AI visibility score weekly and get alerted when changes happen.

Start Free →

🧭 Self-Diffing (Private Layer)

For owned domains, combine this world snapshot with private drift + regression history.
Template Drift
Track in My Site
Drift → Traffic Impact
In development coming soon
Regression Incidents
Track in My Site
Internal Linking
Deep Audit graph
Semantic Structure
GEO view in Deep Audit
Content Quality
Thin/duplicate tracking

🕒 History

Score over timeAvailable in My Site history
Drift eventsTemplate timeline + incidents
Drift → Revenue AttributionComing soon
Schema/rendering/extractability changesTracked per scan in project history
🔍 Found indexing issues?
Run a free deep audit to diagnose crawled-not-indexed, soft 404s, redirect errors, and more.
Free Deep Audit → GSC Error Guide →